제품 > 항체 > 다중클론항체(pAb)

SLC7A1 Rabbit pAb (A14784)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from LNCaP cells, using SLC7A1 Rabbit pAb (A14784) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - SLC7A1 Rabbit pAb (A14784)

Immunohistochemistry analysis of paraffin-embedded Mouse brain using SLC7A1 Rabbit pAb (A14784) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat testis using SLC7A1 Rabbit pAb (A14784) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Overview

Product name	SLC7A1 Rabbit pAb
Catalog No.	A14784
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables L-arginine transmembrane transporter activity and L-histidine transmembrane transporter activity. Involved in amino acid transport. Located in membrane. Part of apical plasma membrane; basolateral plasma membrane; and protein-containing complex.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 530-629 of human SLC7A1 (NP_003036.1).
Sequence	FLLAGSALLCAVVTGVIWRQPESKTKLSFKVPFLPVLPILSIFVNVYLMMQLDQGTWVRFAVWMLIGFIIYFGYGLWHSEEASLDADQARTPDGNLDQCK
Gene ID
Swiss Prot
Synonyms	ERR; ATRC1; CAT-1; HCAT1; REC1L; SLC7A1
Calculated MW	68kDa
Observed MW	68kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	LNCaP
Cellular location	Cell membrane, Multi-pass membrane protein.
Customer validation	WB(Homo sapiens, Other)