제품 > 항체 > 다중클론항체(pAb)

[KD Validated] HNRNPA2B1 Rabbit pAb (A25463)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from wild type (WT) and HNRNPA2B1 knockdown (KD) HeLa cells using [KD Validated] HNRNPA2B1 Rabbit pAb (A25463) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime: 5s.

Western blot analysis of various lysates using [KD Validated] HNRNPA2B1 Rabbit pAb (A25463) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime: 5s.

ABclonal:Immunohistochemistry - [KD Validated] HNRNPA2B1 Rabbit pAb (A25463)

Immunohistochemistry analysis of HNRNPA2B1 in paraffin-embedded Rat testis tissue using [KD Validated] HNRNPA2B1 Rabbit pAb (A25463) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of HNRNPA2B1 in paraffin-embedded Human colon tissue using [KD Validated] HNRNPA2B1 Rabbit pAb (A25463) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of HNRNPA2B1 in paraffin-embedded Rat colon tissue using [KD Validated] HNRNPA2B1 Rabbit pAb (A25463) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of HNRNPA2B1 in paraffin-embedded Human breast cancer tissue using [KD Validated] HNRNPA2B1 Rabbit pAb (A25463) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of HNRNPA2B1 in paraffin-embedded Mouse colon tissue using [KD Validated] HNRNPA2B1 Rabbit pAb (A25463) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Overview

Product name	[KD Validated] HNRNPA2B1 Rabbit pAb
Catalog No.	A25463
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind to RNAs. This gene has been described to generate two alternatively spliced transcript variants which encode different isoforms.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 150-250 of human HNRNPA2B1 (NP_112533.1).
Sequence	GKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGG
Gene ID
Swiss Prot
Synonyms	RNPA2; HNRPA2; HNRPB1; SNRPB1; HNRNPA2; HNRNPB1; IBMPFD2; HNRPA2B1; B1
Calculated MW	37kDa
Observed MW	38kDa/36-40kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HeLa, A549, NIH/3T3, RAW 264.7, PC-12
Cellular location	Cytoplasm, Nucleus, nucleoplasm