Reviews (3)Publications (36) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | [KD Validated] METTL3 Rabbit pAb |
---|---|
Catalog No. | A8370 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-156 of human METTL3 (NP_062826.2). |
---|---|
Sequence | MSDTWSSIQAHKKQLDSLRERLQRRRKQDSGHLDLRNPEAALSPTFRSDSPVPTAPTSGGPKPSTASAVPELATDPELEKKLLHHLSDLALTLPTDAVSICLAISTPDAPATQDGVESLLQKFAAQELIEVKRGLLQDDAHPTLVTYADHSKLSAM |
Gene ID | |
Swiss Prot | |
Synonyms | M6A; IME4; Spo8; MT-A70; hMETTL3; METTL3 |
Calculated MW | 64kDa |
Observed MW | 70kDa/75KDa/75kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | NIH/3T3, 293T, HeLa, Hep G2, Mouse testis |
Cellular location | Nucleus speckle. |
Customer validation | (Human breast cancer, HeLa) Co-IP(Homo sapiens) WB(Rattus norvegicus, Homo sapiens, Mus musculus, Capra hircus, Mus musculus, Other) RIP(Homo sapiens, Mus musculus) PCR(Homo sapiens) IF(Homo sapiens, Mus musculus) IP(Mus musculus) IHC(Mus musculus) IP(Mus musculus) MeRIP(Mus musculus) IHC(Homo sapiens,Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A8370? Please let us know so that we can cite the reference in this datasheet.