제품 > 항체 > 다중클론항체(pAb)

METTL3 Rabbit pAb (A21572)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using METTL3 Rabbit pAb (A21572) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.

ABclonal:Immunohistochemistry - METTL3 Rabbit pAb (A21572)

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using METTL3 Rabbit pAb (A21572) at dilution of 1:20 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human esophagus using METTL3 Rabbit pAb (A21572) at dilution of 1:20 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunoprecipitation - METTL3 Rabbit pAb (A21572)

Immunoprecipitation analysis of 300 μg extracts of 293T cells using 3 μg METTL3 Rabbit pAb (A21572). Western blot was performed from the immunoprecipitate using METTL3 Rabbit pAb (A21572) at a dilution of 1:1000.

Overview

Product name	METTL3 Rabbit pAb
Catalog No.	A21572
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes the 70 kDa subunit of MT-A which is part of N6-adenosine-methyltransferase. This enzyme is involved in the posttranscriptional methylation of internal adenosine residues in eukaryotic mRNAs, forming N6-methyladenosine.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-156 of human METTL3 (NP_062826.2).
Sequence	MSDTWSSIQAHKKQLDSLRERLQRRRKQDSGHLDLRNPEAALSPTFRSDSPVPTAPTSGGPKPSTASAVPELATDPELEKKLLHHLSDLALTLPTDAVSICLAISTPDAPATQDGVESLLQKFAAQELIEVKRGLLQDDAHPTLVTYADHSKLSAM
Gene ID
Swiss Prot
Synonyms	M6A; IME4; Spo8; MT-A70; hMETTL3; METTL3
Calculated MW	64kDa
Observed MW	75kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:10 - 1:20 IHC-P 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	NIH/3T3, Mouse testis, Rat thymus
Cellular location	Nucleus speckle
Customer validation	WB(Homo sapiens)