Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | [KD Validated] MTMR3 Rabbit pAb |
---|---|
Catalog No. | A10806 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 640-810 of human MTMR3 (NP_066576.1). |
---|---|
Sequence | KWQEHRRSLELSSLAGPGEDPLSADSLGKPTRVPGGAELSVAAGVAEGQMENILQEATKEESGVEEPAHRAGIEIQEGKEDPLLEKESRRKTPEASAIGLHQDPELGDAALRSHLDMSWPLFSQGISEQQSGLSVLLSSLQVPPRGEDSLEVPVEQFRIEEIAEGREEAVL |
Gene ID | |
Swiss Prot | |
Synonyms | ZFYVE10; FYVE-DSP1; [KD Validated] MTMR3 |
Calculated MW | 134kDa |
Observed MW | 130-150kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | 293T |
Cellular location | Cytoplasm, Membrane, Peripheral membrane protein |
Customer validation | WB(Gallus gallus, Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A10806? Please let us know so that we can cite the reference in this datasheet.