제품 > 항체 > 단일클론항체(mAb)

[KD Validated] RGAP1 Rabbit mAb (A24948)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using [KD Validated] RGAP1 Rabbit mAb (A24948) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Western blot analysis of lysates from wild type (WT) and RGAP1 knockdown (KD) HeLa cells using [KD Validated] RGAP1 Rabbit mAb (A24948) at 1:800 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - [KD Validated] RGAP1 Rabbit mAb (A24948)

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using [KD Validated] RGAP1 Rabbit mAb (A24948) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using [KD Validated] RGAP1 Rabbit mAb (A24948) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human colon tissue using [KD Validated] RGAP1 Rabbit mAb (A24948) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using [KD Validated] RGAP1 Rabbit mAb (A24948) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human testis tissue using [KD Validated] RGAP1 Rabbit mAb (A24948) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using [KD Validated] RGAP1 Rabbit mAb (A24948) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Overview

Product name	[KD Validated] RGAP1 Rabbit mAb
Catalog No.	A24948
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC57331

Background

This gene encodes a GTPase-activating protein (GAP) that is a compoment of the centralspindlin complex. This protein binds activated forms of Rho GTPases and stimulates GTP hydrolysis, which results in negative regulation of Rho-mediated signals. This protein plays a regulatory role in cytokinesis, cell growth, and differentiation. Alternatively spliced transcript variants have been found for this gene. There is a pseudogene for this gene on chromosome 12.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 533-632 of human RGAP1 (NP_037409.2).
Sequence	SLPLEYWSQFMMVEQENIDPLHVIENSNAFSTPQTPDIKVSLLGPVTTPEHQLLKTPSSSSLSQRVRSTLTKNTPRFGSKSKSATNLGRQGNFFASPMLK
Gene ID
Swiss Prot
Synonyms	CYK4; CDAN3B; ID-GAP; HsCYK-4; MgcRacGAP; [KD Validated] RGAP1
Calculated MW	71kDa
Observed MW	70-75kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:12000 IHC-P 1:100 - 1:400 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HeLa, T-47D, K-562, Mouse thymus, Mouse testis, Mouse heart, Rat testis
Cellular location	Cell membrane, Cleavage furrow, Cytoplasm, Cytoplasmic side, Cytoplasmic vesicle, Midbody, Nucleus, Peripheral membrane protein, acrosome, cytoskeleton, secretory vesicle, spindle.