제품 > 항체 > 다중클론항체(pAb)

RGAP1 Rabbit pAb (A5298)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using RGAP1 Rabbit pAb (A5298) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - RGAP1 Rabbit pAb (A5298)

Immunohistochemistry analysis of paraffin-embedded Human breast cancer using RGAP1 Rabbit pAb (A5298) at dilution of 1:50 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using RGAP1 Rabbit pAb (A5298) at dilution of 1:50 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - RGAP1 Rabbit pAb (A5298)

Immunofluorescence analysis of U2OS cells using RGAP1 Rabbit pAb (A5298). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	RGAP1 Rabbit pAb
Catalog No.	A5298
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a GTPase-activating protein (GAP) that is a compoment of the centralspindlin complex. This protein binds activated forms of Rho GTPases and stimulates GTP hydrolysis, which results in negative regulation of Rho-mediated signals. This protein plays a regulatory role in cytokinesis, cell growth, and differentiation. Alternatively spliced transcript variants have been found for this gene. There is a pseudogene for this gene on chromosome 12.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 353-632 of human RGAP1 (NP_001119576.1).
Sequence	DFVSQTSPMIPSIVVHCVNEIEQRGLTETGLYRISGCDRTVKELKEKFLRVKTVPLLSKVDDIHAICSLLKDFLRNLKEPLLTFRLNRAFMEAAEITDEDNSIAAMYQAVGELPQANRDTLAFLMIHLQRVAQSPHTKMDVANLAKVFGPTIVAHAVPNPDPVTMLQDIKRQPKVVERLLSLPLEYWSQFMMVEQENIDPLHVIENSNAFSTPQTPDIKVSLLGPVTTPEHQLLKTPSSSSLSQRVRSTLTKNTPRFGSKSKSATNLGRQGNFFASPMLK
Gene ID
Swiss Prot
Synonyms	CYK4; CDAN3B; ID-GAP; HsCYK-4; MgcRacGAP; RGAP1
Calculated MW	71kDa
Observed MW	71kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:100 - 1:500 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HeLa, 293T, K-562, Mouse testis, Mouse thymus, Rat testis
Cellular location	Cell membrane, Cleavage furrow, Cytoplasm, Cytoplasmic side, Cytoplasmic vesicle, Midbody, Nucleus, Peripheral membrane protein, acrosome, cytoskeleton, secretory vesicle, spindle
Customer validation	WB(Homo sapiens,Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

RGAP1 Rabbit pAb images

Western blot - RGAP1 Rabbit pAb (A5298)

Immunohistochemistry - RGAP1 Rabbit pAb (A5298)

Immunofluorescence - RGAP1 Rabbit pAb (A5298)

Immunofluorescence analysis of U2OS cells using RGAP1 Rabbit pAb (A5298). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.