제품 > 항체 > 단일클론항체(mAb)

[KD Validated] TIFAB Rabbit mAb (A24024)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from wild type (WT) and 293T cells transfected with TIFAB using [KD Validated] TIFAB Rabbit mAb (A24024) at 1:2000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
WB samples for antibody validation are kindly provided by Dr. Feng Shao, NIBS

Western blot analysis of lysates from wild type (WT) and TIFAB knockdown (KD) MV-4-11 cells using [KD Validated] TIFAB Rabbit mAb (A24024) at 1:2000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
WB samples for antibody validation are kindly provided by Dr. Feng Shao, NIBS

Review

Overview

Product name	[KD Validated] TIFAB Rabbit mAb
Catalog No.	A24024
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC62261

Background

TIFAB binds to TIFA (MIM 609028) and inhibits TIFA mediated NF kappa-B (NFKB1; MIM 164011) activation.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 62-161 of human TIFAB(NP_001092691.1)
Sequence	PYLEKGSALLAFCLKALSRKGCVWVNGLTLRYLEQVPLSTVNRVSFSGIQMLVRVEEGTSLEAFVCYFHVSPSPLIYRPEAEETDEWEGISQGQPPPGSG
Gene ID
Swiss Prot
Synonyms
Calculated MW	18KDa
Observed MW	18kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	293T transfected with TIFAB（Human）, MV-4-11
Cellular location	Cytoplasm.
Customer validation	(HeLa cells)