제품 > 항체 > 단일클론항체(mAb)

KHDRBS1/Sam68 Rabbit mAb (A3886)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using KHDRBS1/KHDRBS1/Sam68 Rabbit mAb (A3886) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - KHDRBS1/Sam68 Rabbit mAb (A3886)

Immunohistochemistry analysis of paraffin-embedded rat brain using KHDRBS1/KHDRBS1/Sam68 Rabbit mAb (A3886) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human colon using KHDRBS1/KHDRBS1/Sam68 Rabbit mAb (A3886) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse brain using KHDRBS1/KHDRBS1/Sam68 Rabbit mAb (A3886) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - KHDRBS1/Sam68 Rabbit mAb (A3886)

Confocal imaging of C6 cells using KHDRBS1/Sam68 Rabbit mAb (A3886, at dilution of 1:100) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Confocal imaging of NIH/3T3 cells using KHDRBS1/Sam68 Rabbit mAb (A3886, at dilution of 1:100) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Confocal imaging of U-2 OS cells using KHDRBS1/Sam68 Rabbit mAb (A3886, at dilution of 1:100) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Overview

Product name	KHDRBS1/Sam68 Rabbit mAb
Catalog No.	A3886
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0858

Background

This gene encodes a member of the K homology domain-containing, RNA-binding, signal transduction-associated protein family. The encoded protein appears to have many functions and may be involved in a variety of cellular processes, including alternative splicing, cell cycle regulation, RNA 3'-end formation, tumorigenesis, and regulation of human immunodeficiency virus gene expression. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KHDRBS1 (Q07666).
Sequence	MQRRDDPAARMSRSSGRSGSMDPSGAHPSVRQTPSRQPPLPHRSRGGGGGSRGGARASPATQPPPLLPPSATGPDATVGGPAPTPLLPPSATASVKMEPE
Gene ID
Swiss Prot
Synonyms	p62; p68; Sam68; KHDRBS1/Sam68
Calculated MW	48kDa
Observed MW	68kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HeLa, HepG2, NIH/3T3, Jurkat, Rat testis
Cellular location	Membrane, Nucleus