제품 > 항체 > 다중클론항체(pAb)

KHDRBS1/Sam68 Rabbit pAb (A6101)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using KHDRBS1/Sam68 Rabbit pAb (A6101) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - KHDRBS1/Sam68 Rabbit pAb (A6101)

Immunohistochemistry analysis of paraffin-embedded Rat brain using KHDRBS1/Sam68 Rabbit pAb (A6101) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human prostate cancer using KHDRBS1/Sam68 Rabbit pAb (A6101) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human stomach using KHDRBS1/Sam68 Rabbit pAb (A6101) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Mouse liver using KHDRBS1/Sam68 Rabbit pAb (A6101) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - KHDRBS1/Sam68 Rabbit pAb (A6101)

Confocal immunofluorescence analysis of HeLa cells using KHDRBS1/Sam68 Rabbit pAb (A6101) at dilution of 1:400. Blue: DAPI for nuclear staining.

Confocal immunofluorescence analysis of U2OS cells using KHDRBS1/Sam68 Rabbit pAb (A6101) at dilution of 1:400. Blue: DAPI for nuclear staining.

Review

Overview

Product name	KHDRBS1/Sam68 Rabbit pAb
Catalog No.	A6101
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a member of the K homology domain-containing, RNA-binding, signal transduction-associated protein family. The encoded protein appears to have many functions and may be involved in a variety of cellular processes, including alternative splicing, cell cycle regulation, RNA 3'-end formation, tumorigenesis, and regulation of human immunodeficiency virus gene expression. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 343-443 of human KHDRBS1/Sam68 (NP_006550.1).
Sequence	PAPRARTAGIQRIPLPPPPAPETYEEYGYDDTYAEQSYEGYEGYYSQSQGDSEYYDYGHGEVQDSYEAYGQDDWNGTRPSLKAPPARPVKGAYREHPYGRY
Gene ID
Swiss Prot
Synonyms	p62; p68; Sam68; KHDRBS1/Sam68
Calculated MW	48kDa
Observed MW	68kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:100 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	SKOV3, HeLa, Jurkat, PC-12, Mouse brain, Rat brain
Cellular location	Membrane, Nucleus
Customer validation	(Zebrafish retina) WB(Homo sapiens, Mus musculus) IHC(Homo sapiens, Mus musculus)