Review (2)Publications (14) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | [KO Validated] CDK2 Rabbit mAb |
---|---|
Catalog No. | A0094 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0222 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 199-298 of human CDK2 (P24941). |
---|---|
Sequence | RRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL |
Gene ID | |
Swiss Prot | |
Synonyms | CDKN2; p33(CDK2); K2 |
Calculated MW | 34kDa |
Observed MW | 33kDa/38kDa(mouse rat) |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HeLa, 293T, Jurkat, Mouse spleen, Rat testis |
Cellular location | Cajal body, Cytoplasm, Endosome, Nucleus, centrosome, cytoskeleton, microtubule organizing center. |
Customer validation | (HeLa 、PC-3、Jurkat 、HT29 、393T 、 RAMOS 、NCI-N87 、U2-OS , Hela PC-3 Jurkat HT-29 293T RAMOS NCI-N87 U2-OS FUOV-1) WB(Homo sapiens, Sus scrofa, Mus musculus, Oryctolagus cuniculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A0094? Please let us know so that we can cite the reference in this datasheet.