제품 > 항체 > 다중클론항체(pAb)

[KO Validated] Fascin/FSCN1 Rabbit pAb (A1904)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using [KO Validated] Fascin/FSCN1 Rabbit pAb (A1904) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Western blot analysis of lysates from wild type (WT) and Fascin/Fascin/FSCN1 knockout (KO) HeLa cells, using [KO Validated] Fascin/FSCN1 Rabbit pAb (A1904) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunohistochemistry - [KO Validated] Fascin/FSCN1 Rabbit pAb (A1904)

Immunohistochemistry analysis of paraffin-embedded mouse testis using [KO Validated] Fascin/FSCN1 Rabbit pAb (A1904) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - [KO Validated] Fascin/FSCN1 Rabbit pAb (A1904)

Immunofluorescence analysis of C6 cells using [KO Validated] Fascin/Fascin/FSCN1 Rabbit pAb (A1904) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH-3T3 cells using [KO Validated] Fascin/Fascin/FSCN1 Rabbit pAb (A1904) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review

Overview

Product name	[KO Validated] Fascin/FSCN1 Rabbit pAb
Catalog No.	A1904
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a member of the fascin family of actin-binding proteins. Fascin proteins organize F-actin into parallel bundles, and are required for the formation of actin-based cellular protrusions. The encoded protein plays a critical role in cell migration, motility, adhesion and cellular interactions. Expression of this gene is known to be regulated by several microRNAs, and overexpression of this gene may play a role in the metastasis of multiple types of cancer by increasing cell motility. Expression of this gene is also a marker for Reed-Sternberg cells in Hodgkin's lymphoma. A pseudogene of this gene is located on the long arm of chromosome 15.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 394-493 of human Fascin/Fascin/FSCN1 (NP_003079.1).
Sequence	FIGCRKVTGTLDANRSSYDVFQLEFNDGAYNIKDSTGKYWTVGSDSAVTSSGDTPVDFFFEFCDYNKVAIKVGGRYLKGDHAGVLKASAETVDPASLWEY
Gene ID
Swiss Prot
Synonyms	HSN; SNL; p55; FAN1; N1
Calculated MW	55kDa
Observed MW	50kDa, 55kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	U-251MG, HeLa, NCI-H460, HepG2, SH-SY5Y, Mouse brain, Mouse spinal cord
Cellular location	Cell junction, Cell projection, Cytoplasm, cytoskeleton, cytosol, filopodium, invadopodium, microvillus
Customer validation	(Mouse keRatinocytes) WB(Homo sapiens)