제품 > 항체 > 다중클론항체(pAb)

[KO Validated] GARS Rabbit pAb (A5435)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using GARS Rabbit pAb (A5435) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Western blot analysis of lysates from wild type(WT) and GARS knockout (KO) 293T cells, using GARS Rabbit pAb (A5435) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - [KO Validated] GARS Rabbit pAb (A5435)

Immunohistochemistry analysis of paraffin-embedded Human lung cancer using GARS Rabbit pAb (A5435) at dilution of 1:300 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer using GARS Rabbit pAb (A5435) at dilution of 1:300 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Mouse liver using GARS Rabbit pAb (A5435) at dilution of 1:300 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Rat brain using GARS Rabbit pAb (A5435) at dilution of 1:300 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Rat testis using GARS Rabbit pAb (A5435) at dilution of 1:300 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - [KO Validated] GARS Rabbit pAb (A5435)

Confocal immunofluorescence analysis of NIH-3T3 cells using [KO Validated] GARS Rabbit pAb (A5435) at dilution of 1:200. Blue: DAPI for nuclear staining.

Overview

Product name	[KO Validated] GARS Rabbit pAb
Catalog No.	A5435
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes glycyl-tRNA synthetase, one of the aminoacyl-tRNA synthetases that charge tRNAs with their cognate amino acids. The encoded enzyme is an (alpha)2 dimer which belongs to the class II family of tRNA synthetases. It has been shown to be a target of autoantibodies in the human autoimmune diseases, polymyositis or dermatomyositis. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 60-370 of human GARS (NP_002038.2).
Sequence	AEEVLAPLRLAVRQQGDLVRKLKEDKAPQVDVDKAVAELKARKRVLEAKELALQPKDDIVDRAKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNIIQTWRQHFIQEEQILEIDCTMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRADHLLKAHLQKLMSDKKCSVEKKSEMESVLAQLDNYGQQELADLFVNYNVKSPITGNDLSPPVSFNLMFKTFIGPGGNMPGYLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPSEKDHPKFQNVAD
Gene ID
Swiss Prot
Synonyms	GARS; HMN5; CMT2D; DSMAV; GlyRS; HMN5A; SMAD1; SMAJI; RS
Calculated MW	83kDa
Observed MW	76kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:100 - 1:500 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	293T, Jurkat, SH-SY5Y
Cellular location	Cell projection, Cytoplasm, Mitochondrion, axon

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] GARS Rabbit pAb images

Western blot - [KO Validated] GARS Rabbit pAb (A5435)

Immunohistochemistry - [KO Validated] GARS Rabbit pAb (A5435)

Immunofluorescence - [KO Validated] GARS Rabbit pAb (A5435)

Confocal immunofluorescence analysis of NIH-3T3 cells using [KO Validated] GARS Rabbit pAb (A5435) at dilution of 1:200. Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.