Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of extracts from wild type (WT) and GATA2 knockout (KO) HeLa cells, using GATA2 antibody (A5083) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.
Western blot analysis of extracts of various cell lines, using GATA2 Rabbit mAb (A5083) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.
| Product name | [KO Validated] GATA2/3 Rabbit mAb |
|---|---|
| Catalog No. | A5083 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC1209 |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human GATA2/3 (NP_116027.2). |
|---|---|
| Sequence | MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARGEDKDG |
| Gene ID | |
| Swiss Prot | |
| Synonyms | DCML; IMD21; MONOMAC; NFE1B |
| Calculated MW | 51kDa |
| Observed MW | 51kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | HeLa, Mouse lung, Rat lung |
| Cellular location | Nucleus, Endoplasmic reticulum membrane |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
![ABclonal:Western blot - [KO Validated] GATA2/3 Rabbit mAb (A5083)](https://abclonal.oss-cn-hangzhou.aliyuncs.com/A5083_ARC1209_KO-WB_01.jpg?t=1698886043 "ABclonal:Western blot - [KO Validated] GATA2/3 Rabbit mAb (A5083)")
![ABclonal:Western blot - [KO Validated] GATA2/3 Rabbit mAb (A5083)](https://abclonal.oss-cn-hangzhou.aliyuncs.com/A5083_ARC1209_WB_01.jpg?t=1698886043 "ABclonal:Western blot - [KO Validated] GATA2/3 Rabbit mAb (A5083)")
