제품 > 항체 > 단일클론항체(mAb)

[KO Validated] HIF-1-alpha Rabbit mAb (A24002)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of lysates from wild type(WT) and HIF-1-alpha Rabbit mAb knockout (KO) NIH/3T3, NIH/3T3 Cobalt chloride cells, using HIF-1-alpha Rabbit mAb (A24002) at 1:400 dilution. NIH/3T3 cells were treated by Cobalt chloride (300μM) at 37℃ for 6 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Western blot analysis of lysates from wild type(WT) and HIF-1-alpha knockout (KO) Hela cells, using HIF-1-alpha Rabbit mAb (A24002) at 1:400 dilution. Hela cells were treated by Cobalt chloride (250μM) at 37℃ for 16 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Review

Overview

Product name	[KO Validated] HIF-1-alpha Rabbit mAb
Catalog No.	A24002
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC3208

Background

This gene encodes the alpha subunit of transcription factor hypoxia-inducible factor-1 (HIF-1), which is a heterodimer composed of an alpha and a beta subunit. HIF-1 functions as a master regulator of cellular and systemic homeostatic response to hypoxia by activating transcription of many genes, including those involved in energy metabolism, angiogenesis, apoptosis, and other genes whose protein products increase oxygen delivery or facilitate metabolic adaptation to hypoxia. HIF-1 thus plays an essential role in embryonic vascularization, tumor angiogenesis and pathophysiology of ischemic disease. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 300-550 of human HIF-1-alpha (NP_001521.1).
Sequence	VTTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTECVLKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTETDDQQLEEVPLYNDVMLPSPNEKLQNINLAMSPLPTAETPKPLRSSADPALNQEVALKLEPNPESLELSFTMPQIQDQTPSPSDGSTRQSSPEPNSPSEYCFYVDSDMVNEFKLELVEKLFAEDTEAKNPF
Gene ID
Swiss Prot
Synonyms	HIF1; MOP1; PASD8; HIF-1A; bHLHe78; HIF-1alpha; HIF1-ALPHA; HIF-1-alpha; ha
Calculated MW	93kDa
Observed MW	120kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:100 - 1:500 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Hela treated by Cobalt chloride, NIH/3T3 treated by Cobalt chloride
Cellular location	axon cytoplasm, cytoplasm, cytosol, nuclear body, nuclear speck, nucleoplasm, nucleus.
Customer validation	(SH-SY5Y) WB(Homo sapiens)