Review (1)Publications (16) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | [KO Validated] IRF3 Rabbit mAb |
---|---|
Catalog No. | A19717 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0198 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human IRF3 (Q14653). |
---|---|
Sequence | DFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQPDTSPDTNGGGSTSDTQEDILDELLGNMVLA |
Gene ID | |
Swiss Prot | |
Synonyms | IIAE7; F3 |
Calculated MW | 47kDa |
Observed MW | 57kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Jurkat, 293T, HeLa |
Cellular location | Cytoplasm, Nucleus. |
Customer validation | (T47D、HeLa、 U2-OS、 PC-3、 RPMI-Q26、 MOLT4、 293T) WB(Homo sapiens, Mus musculus, Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A19717? Please let us know so that we can cite the reference in this datasheet.