제품 > 항체 > 다중클론항체(pAb)

[KO Validated] NBS1/NBN Rabbit pAb (A0783)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from wild type (WT) and NBS1/NBS1/NBN knockout (KO) 293T cells, using [KO Validated] NBS1/NBN Rabbit pAb (A0783) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - [KO Validated] NBS1/NBN Rabbit pAb (A0783)

Immunohistochemistry analysis of paraffin-embedded Human lung cancer using [KO Validated] NBS1/NBS1/NBN Rabbit pAb (A0783) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Review

Overview

Product name	[KO Validated] NBS1/NBN Rabbit pAb
Catalog No.	A0783
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Mutations in this gene are associated with Nijmegen breakage syndrome, an autosomal recessive chromosomal instability syndrome characterized by microcephaly, growth retardation, immunodeficiency, and cancer predisposition. The encoded protein is a member of the MRE11/RAD50 double-strand break repair complex which consists of 5 proteins. This gene product is thought to be involved in DNA double-strand break repair and DNA damage-induced checkpoint activation.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 520-754 of human NBS1/NBN (NP_002476.2).
Sequence	NNLFTDTDLKSIVKNSASKSHAAEKLRSNKKREMDDVAIEDEVLEQLFKDTKPELEIDVKVQKQEEDVNVRKRPRMDIETNDTFSDEAVPESSKISQENEIGKKRELKEDSLWSAKEISNNDKLQDDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDLFRYNPYLKRRR
Gene ID
Swiss Prot
Synonyms	ATV; NBS; P95; NBS1; AT-V1; AT-V2; BN
Calculated MW	85kDa
Observed MW	95kDa/70kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	293T, Mouse testis, Rat testis
Cellular location	Chromosome, Nucleus, PML body, telomere.
Customer validation	(Mouse adipose-derived stem cells) WB(Homo sapiens, Mus musculus) IF(Mus musculus)