제품 > 항체 > 다중클론항체(pAb)

NBS1/NBN Rabbit pAb (A7703)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using NBS1/NBN Rabbit pAb (A7703) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 10s.

ABclonal:Immunofluorescence - NBS1/NBN Rabbit pAb (A7703)

Immunofluorescence analysis of U2OS cells using NBS1/NBN Rabbit pAb (A7703) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	NBS1/NBN Rabbit pAb
Catalog No.	A7703
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Mutations in this gene are associated with Nijmegen breakage syndrome, an autosomal recessive chromosomal instability syndrome characterized by microcephaly, growth retardation, immunodeficiency, and cancer predisposition. The encoded protein is a member of the MRE11/RAD50 double-strand break repair complex which consists of 5 proteins. This gene product is thought to be involved in DNA double-strand break repair and DNA damage-induced checkpoint activation.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 650-750 of human NBS1/NBS1/NBN (NP_002476.2).
Sequence	LPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDLFRYNPYL
Gene ID
Swiss Prot
Synonyms	ATV; NBS; P95; NBS1; AT-V1; AT-V2; NBS1/NBN
Calculated MW	85kDa
Observed MW	100kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Jurkat, HeLa, MCF7, Mouse heart, Rat kidney
Cellular location	Chromosome, Nucleus, PML body, telomere.
Customer validation	WB(Homo sapiens) IF(Homo sapiens) IF(Homo sapiens) IP(Homo sapiens) WB(Homo sapiens)