제품 > 항체 > 단일클론항체(mAb)

NBS1/NBN Rabbit mAb (A4197)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from PC-3 cells, using NBS1/NBN Rabbit mAb (A4197) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunoprecipitation - NBS1/NBN Rabbit mAb (A4197)

Immunoprecipitation analysis of 300 μg extracts of 293T cells using 3 μg NBS1/NBN antibody (A4197). Western blot was performed from the immunoprecipitate using NBS1/NBN antibody (A4197) at a dilution of 1:1000.

Overview

Product name	NBS1/NBN Rabbit mAb
Catalog No.	A4197
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0926

Background

Mutations in this gene are associated with Nijmegen breakage syndrome, an autosomal recessive chromosomal instability syndrome characterized by microcephaly, growth retardation, immunodeficiency, and cancer predisposition. The encoded protein is a member of the MRE11/RAD50 double-strand break repair complex which consists of 5 proteins. This gene product is thought to be involved in DNA double-strand break repair and DNA damage-induced checkpoint activation.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 655-754 of human NBS1/NBN (O60934).
Sequence	LLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDLFRYNPYLKRRR
Gene ID
Swiss Prot
Synonyms	ATV; NBS; P95; NBS1; AT-V1; AT-V2; NBS1/NBN
Calculated MW	85kDa
Observed MW	95kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	239T, HeLa
Cellular location	Chromosome, Nucleus, PML body, Telomere
Customer validation	IF(Homo sapiens,Mus musculus) WB(Homo sapiens,Mus musculus)