제품 > 항체 > 단일클론항체(mAb)

[KO Validated] NRF2 Rabbit mAb (A3577)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Chromatin immunoprecipitation was performed with cross-linked chromatin from HepG2 cells, using Nrf2 Rabbit mAb (A3577) and rabbit IgG (AC042). The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram compares the ratio of the immunoprecipitated DNA versus the input.

ABclonal:Western blot - [KO Validated] NRF2 Rabbit mAb (A3577)

Western blot analysis of extracts from wild type(WT) and NRF2 knockout (KO) HeLa cells, using [KO Validated] NRF2 Rabbit mAb (A3577) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Overview

Product name	[KO Validated] NRF2 Rabbit mAb
Catalog No.	A3577
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0806

Background

This gene encodes a transcription factor which is a member of a small family of basic leucine zipper (bZIP) proteins. The encoded transcription factor regulates genes which contain antioxidant response elements (ARE) in their promoters; many of these genes encode proteins involved in response to injury and inflammation which includes the production of free radicals. Multiple transcript variants encoding different isoforms have been characterized for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 505-605 of human NRF2 (NP_006155.2).
Sequence	GKNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLLKEKGENDKSLHLLKKQLSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGNVFLVPKSKKPDVKKN
Gene ID
Swiss Prot
Synonyms	NRF2; HEBP1; Nrf-2; IMDDHH; F2
Calculated MW	68kDa
Observed MW	103kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements. ChIP 5μg antibody for 5μg-10μg of Chromatin
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	293T, HeLa
Cellular location	centrosome, cytoplasm, cytosol, Golgi apparatus, nucleoplasm, nucleus, plasma membrane.
Customer validation	WB(Homo sapiens, Mus musculus, Other) IF(Rattus norvegicus)