Review (1)Publication (1) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Western blot analysis of lysates from wild type (WT) and RAB1B knockout (KO) HeLa cells using [KO Validated] RAB1B Rabbit pAb RAB1B Rabbit pAb (A7514) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
| Product name | [KO Validated] RAB1B Rabbit pAb |
|---|---|
| Catalog No. | A7514 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 7-201 of human RAB1B (NP_112243.1). |
|---|---|
| Sequence | YLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC |
| Gene ID | |
| Swiss Prot | |
| Synonyms | RAB1B |
| Calculated MW | 22kDa |
| Observed MW | 22kDa |
| Reactivity | Human, Mouse |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | HeLa |
| Cellular location | Cytoplasm, Cytoplasmic side, Lipid-anchor, Membrane, Preautophagosomal structure membrane. |
| Customer validation | (Human liver cancer) WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A7514? Please let us know so that we can cite the reference in this datasheet.
![ABclonal:Western blot - [KO Validated] RAB1B Rabbit pAb (A7514)](https://img.abclonal.com/abclonal-manage/Catalog/A7514/A7514_1.jpg?t=1725355960 "ABclonal:Western blot - [KO Validated] RAB1B Rabbit pAb (A7514)")
![ABclonal: review for [KO Validated] RAB1B Rabbit pAb(A7514)](/Uploads/ReviewImages/A7514_20200106171957_FB0000792.jpg "ABclonal: review for [KO Validated] RAB1B Rabbit pAb(A7514)")
