Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using [KO Validated] SLC25A22 Rabbit pAb (A17772) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Western blot analysis of lysates from wild type (WT) and SLC25A22 knockout (KO) 293T cells, using [KO Validated] SLC25A22 Rabbit pAb (A17772) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunofluorescence analysis of C6 cells using [KO Validated] SLC25A22 Rabbit pAb (A17772) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Product name | [KO Validated] SLC25A22 Rabbit pAb |
|---|---|
| Catalog No. | A17772 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 128-188 of human SLC25A22 (NP_078974.1). |
|---|---|
| Sequence | KIQLQDAGRIAAQRKILAAQGQLSAQGGAQPSVEAPAAPRPTATQLTRDLLRSRGIAGLYK |
| Gene ID | |
| Swiss Prot | |
| Synonyms | GC1; DEE3; GC-1; EIEE3; NET44; 22 |
| Calculated MW | 34kDa |
| Observed MW | 34kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence |
| Positive samples | U-87MG, HepG2, A-549, A-431, Mouse brain, Rat brain, 293T |
| Cellular location | mitochondrial inner membrane. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
![ABclonal:Western blot - [KO Validated] SLC25A22 Rabbit pAb (A17772)](https://img.abclonal.com/abclonal-manage/Catalog/A17772/A17772_1.jpg?t=1729141628 "ABclonal:Western blot - [KO Validated] SLC25A22 Rabbit pAb (A17772)")
![ABclonal:Western blot - [KO Validated] SLC25A22 Rabbit pAb (A17772)](https://img.abclonal.com/abclonal-manage/Catalog/A17772/A17772_2.jpg?t=1729141628 "ABclonal:Western blot - [KO Validated] SLC25A22 Rabbit pAb (A17772)")
![ABclonal:Immunofluorescence - [KO Validated] SLC25A22 Rabbit pAb (A17772)](https://img.abclonal.com/abclonal-manage/Catalog/A17772/A17772_3.jpg?t=1729141628 "ABclonal:Immunofluorescence - [KO Validated] SLC25A22 Rabbit pAb (A17772)")
![ABclonal:Immunofluorescence - [KO Validated] SLC25A22 Rabbit pAb (A17772)](https://img.abclonal.com/abclonal-manage/Catalog/A17772/A17772_4.jpg?t=1729141628 "ABclonal:Immunofluorescence - [KO Validated] SLC25A22 Rabbit pAb (A17772)")
