제품 > 항체 > 단일클론항체(mAb)

[KO Validated] SMARCB1/SNF5 Rabbit mAb (A3247)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using SMARCB1/SNF5 Rabbit mAb (A3247) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:2000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Western blot analysis of lysates from wild type(WT) and SMARCB1/SNF5 Rabbit mAb knockout (KO) HeLa(KO) cells, using SMARCB1/SNF5 Rabbit mAb (A3247) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - [KO Validated] SMARCB1/SNF5 Rabbit mAb (A3247)

Immunohistochemistry analysis of paraffin-embedded Human epithelioid sarcoma (ini-1 deletion) using [KO Validated] SMARCB1/SNF5 Rabbit mAb (A3247) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using [KO Validated] SMARCB1/SNF5 Rabbit mAb (A3247) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat lung using [KO Validated] SMARCB1/SNF5 Rabbit mAb (A3247) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse heart using [KO Validated] SMARCB1/SNF5 Rabbit mAb (A3247) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human undifferentiated carcinoma of esophagus using [KO Validated] SMARCB1/SNF5 Rabbit mAb (A3247) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunoprecipitation - [KO Validated] SMARCB1/SNF5 Rabbit mAb (A3247)

Immunoprecipitation of from 300 µg extracts of 293F cells was performed using 3 µg of [KO Validated] SMARCB1/SNF5 Rabbit mAb (A3247). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using [KO Validated] SMARCB1/SNF5 Rabbit mAb (A3247) at a dilution of 1:12000.

Overview

Product name	[KO Validated] SMARCB1/SNF5 Rabbit mAb
Catalog No.	A3247
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC53139

Background

The protein encoded by this gene is part of a complex that relieves repressive chromatin structures, allowing the transcriptional machinery to access its targets more effectively. The encoded nuclear protein may also bind to and enhance the DNA joining activity of HIV-1 integrase. This gene has been found to be a tumor suppressor, and mutations in it have been associated with malignant rhabdoid tumors. Alternatively spliced transcript variants have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 50-150 of human SMARCB1/SNF5 (NP_003064.2).
Sequence	LWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTT
Gene ID
Swiss Prot
Synonyms	RDT; CSS3; INI1; SNF5; Snr1; BAF47; INI-1; MRD15; RTPS1; Sfh1p; hSNFS; SNF5L1; SWNTS1; PPP1R144; F5
Calculated MW	44kDa
Observed MW	44kDa/

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IHC-P 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	293F, K-562, NIH/3T3, Neuro-2a, Rat testis, 293F
Cellular location	Nucleus.