Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | KPNB1 Rabbit pAb |
---|---|
Catalog No. | A8610 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human KPNB1 (NP_002256.2). |
---|---|
Sequence | AAEQGRPPEHTSKFYAKGALQYLVPILTQTLTKQDENDDDDDWNPCKAAGVCLMLLATCCEDDIVPHVLPFIKEHIKNPDWRYRDAAVMAFGCILEGPEPS |
Gene ID | |
Swiss Prot | |
Synonyms | IMB1; IPO1; IPOB; Impnb; NTF97; KPNB1 |
Calculated MW | 97kDa |
Observed MW | 102kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | K-562, HepG2, HeLa, NIH/3T3, C6, PC-12 |
Cellular location | Cytoplasm, Nucleus envelope. |
Customer validation | WB(Homo sapiens, Mus musculus, Mus musculus, Xenopus laevis) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A8610? Please let us know so that we can cite the reference in this datasheet.