Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Immunofluorescence analysis of GFP-RNF168 transgenic U2OS cells using L3MBTL1 antibody (A7090).Green:GFP-RNF168 fusion protein expression for DNA damage marker. Blue:DAPI for nuclear staining.RNF168(GFP) can be used to mark cells damaged by UV-A laser for they always gather around DNA damage region.
| Product name | L3MBTL1 Rabbit pAb |
|---|---|
| Catalog No. | A7090 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 533-772 of human L3MBTL1 (NP_056293.4). |
|---|---|
| Sequence | PLSYRSLPHTRTSKYSFHHRKCPTPGCDGSGHVTGKFTAHHCLSGCPLAERNQSRLKAELSDSEASARKKNLSGFSPRKKPRHHGRIGRPPKYRKIPQEDFQTLTPDVVHQSLFMSALSAHPDRSLSVCWEQHCKLLPGVAGISASTVAKWTIDEVFGFVQTLTGCEDQARLFKDEARIVRVTHVSGKTLVWTVAQLGDLVCSDHLQEGKGILETGVHSLLCSLPTHLLAKLSFASDSQY |
| Gene ID | |
| Swiss Prot | |
| Synonyms | L3MBTL; ZC2HC3; H-L(3)MBT; dJ138B7.3 |
| Calculated MW | 92kDa |
| Observed MW |
| Reactivity | Human |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Immunofluorescence |
| Positive samples | |
| Cellular location | Nucleus |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
