제품 > 항체 > 다중클론항체(pAb)

LAPTM4B Rabbit pAb (A10761)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using LAPTM4B Rabbit pAb (A10761) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Overview

Product name	LAPTM4B Rabbit pAb
Catalog No.	A10761
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables ceramide binding activity; enzyme binding activity; and phosphatidylinositol bisphosphate binding activity. Involved in several processes, including negative regulation of macromolecule metabolic process; regulation of lysosomal membrane permeability; and regulation of lysosome organization. Located in several cellular components, including endosome; lysosomal membrane; and plasma membrane.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 218-317 of human LAPTM4B (NP_060877.3).
Sequence	NSIQEYIRQLPPNFPYRDDVMSVNPTCLVLIILLFISIILTFKGYLISCVWNCYRYINGRNSSDVLVYVTSNDTTVLLPPYDDATVNGAAKEPPPPYVSA
Gene ID
Swiss Prot
Synonyms	LC27; LAPTM4beta; LAPTM4B
Calculated MW	35kDa
Observed MW	37kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	U-87MG, HeLa, A-549, SKOV3, B cells, Mouse brain, Mouse eye, Rat ovary
Cellular location	Endomembrane system, Multi-pass membrane protein
Customer validation	WB(Homo sapiens)