제품 > 항체 > 단일클론항체(mAb)

LI Cadherin/Cadherin-17 Rabbit mAb (A5286)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using LI Cadherin/Cadherin-17 Rabbit mAb (A5286) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - LI Cadherin/Cadherin-17 Rabbit mAb (A5286)

Immunohistochemistry analysis of paraffin-embedded Human gastric cancer using LI Cadherin/Cadherin-17 Rabbit mAb (A5286) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human pancreatic ductal carcinoma using LI Cadherin/Cadherin-17 Rabbit mAb (A5286) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human stomach using LI Cadherin/Cadherin-17 Rabbit mAb (A5286) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunofluorescence - LI Cadherin/Cadherin-17 Rabbit mAb (A5286)

Confocal imaging of Human colon cancer using LI Cadherin/Cadherin-17 Rabbit mAb (A5286, dilution 1:100)(Red). DAPI was used for nuclear staining (blue). Objective: 40x.

Immunofluorescence analysis of paraffin-embedded mouse Intestine using LI Cadherin/Cadherin-17 Rabbit mAb (A5286) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of paraffin-embedded rat rectum using LI Cadherin/Cadherin-17 Rabbit mAb (A5286) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	LI Cadherin/Cadherin-17 Rabbit mAb
Catalog No.	A5286
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1989

Background

This gene is a member of the cadherin superfamily, genes encoding calcium-dependent, membrane-associated glycoproteins. The encoded protein is cadherin-like, consisting of an extracellular region, containing 7 cadherin domains, and a transmembrane region but lacking the conserved cytoplasmic domain. The protein is a component of the gastrointestinal tract and pancreatic ducts, acting as an intestinal proton-dependent peptide transporter in the first step in oral absorption of many medically important peptide-based drugs. The protein may also play a role in the morphological organization of liver and intestine. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LI Cadherin/Cadherin-17 (Q12864).
Sequence	MILQAHLHSLCLLMLYLATGYGQEGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTFELTGETDNIFVIEREGLLYYNRALDRETRSTHNLQVAALD
Gene ID
Swiss Prot
Synonyms	HPT1; CDH16; HPT-1; LI Cadherin/Cadherin-17
Calculated MW	92kDa
Observed MW	120kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IHC-P 1:200 - 1:2000 IF/ICC 1:100 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HT-29 cells, Mouse large intestine
Cellular location	Cell membrane, Single-pass type I membrane protein.
Customer validation	WB(Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

연구세포 생물학 & 발달 생물학세포 접착카드헤린

LI Cadherin/Cadherin-17 Rabbit mAb images

Western blot - LI Cadherin/Cadherin-17 Rabbit mAb (A5286)

Immunohistochemistry - LI Cadherin/Cadherin-17 Rabbit mAb (A5286)

Immunofluorescence - LI Cadherin/Cadherin-17 Rabbit mAb (A5286)

Confocal imaging of Human colon cancer using LI Cadherin/Cadherin-17 Rabbit mAb (A5286, dilution 1:100)(Red). DAPI was used for nuclear staining (blue). Objective: 40x.

Immunofluorescence - LI Cadherin/Cadherin-17 Rabbit mAb (A5286)

* For research use only. Not for therapeutic or diagnostic purposes.