제품 > 항체 > 다중클론항체(pAb)

LIN28A Rabbit pAb (A6034)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of lysates from T47D cells, using LIN28A Rabbit pAb (A6034) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunohistochemistry - LIN28A Rabbit pAb (A6034)

Immunohistochemistry analysis of paraffin-embedded Human testicular seminoma using NY-ESO-1 Rabbit pAb (A6034) at dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Review

Overview

Product name	LIN28A Rabbit pAb
Catalog No.	A6034
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a LIN-28 family RNA-binding protein that acts as a posttranscriptional regulator of genes involved in developmental timing and self-renewal in embryonic stem cells. The encoded protein functions through direct interaction with target mRNAs and by disrupting the maturation of certain miRNAs involved in embryonic development. This protein prevents the terminal processing of the LET7 family of microRNAs which are major regulators of cellular growth and differentiation. Aberrant expression of this gene is associated with cancer progression in multiple tissues.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-209 of human LIN28A (NP_078950.1).
Sequence	SAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN
Gene ID
Swiss Prot
Synonyms	CSDD1; LIN28; LIN-28; ZCCHC1; lin-28A; LIN28A
Calculated MW	23kDa
Observed MW	28kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	T47D
Cellular location	Cytoplasm, Nucleus, nucleolus
Customer validation	(P19) IP(Mus musculus)