제품 > 항체 > 다중클론항체(pAb)

LLGL2 Rabbit pAb (A13323)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of various lysates using LLGL2 Rabbit pAb (A13323) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Overview

Product name	LLGL2 Rabbit pAb
Catalog No.	A13323
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable GTPase activator activity; PDZ domain binding activity; and myosin II binding activity. Acts upstream of or within establishment or maintenance of polarity of embryonic epithelium; labyrinthine layer development; and post-embryonic development. Predicted to be located in cytosol and intracellular membrane-bounded organelle. Predicted to be active in cortical actin cytoskeleton and plasma membrane. Is expressed in several structures, including cardiovascular system; endocrine gland; genitourinary system; gut; and nasal cavity epithelium. Orthologous to human LLGL2 (LLGL scribble cell polarity complex component 2).

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 938-1027 of mouse LLGL2 (NP_663413.2).
Sequence	DSTKAKKHNRPSNGNGTGLKMTSSGHVRNSKSQSDGDEKKPGPVMEHALLNDAWVLKEIQSTLEGDRRSYGNWHPHRVAVGCRLSNGEAE
Gene ID
Swiss Prot
Synonyms	Llglh2; 9130006H11Rik; LLGL2
Calculated MW	114kDa
Observed MW	114kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse lung, Mouse testis, Rat lung
Cellular location	Cytoplasm.