제품 > 항체 > 다중클론항체(pAb)

LLGL2 Rabbit pAb (A8284)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using LLGL2 antibody (A8284) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 5s.

ABclonal:Immunofluorescence - LLGL2 Rabbit pAb (A8284)

Immunofluorescence analysis of U2OS cells using LLGL2 antibody (A8284) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	LLGL2 Rabbit pAb
Catalog No.	A8284
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable GTPase activator activity; PDZ domain binding activity; and myosin II binding activity. Acts upstream of or within establishment or maintenance of polarity of embryonic epithelium; labyrinthine layer development; and post-embryonic development. Predicted to be located in cytosol and intracellular membrane-bounded organelle. Predicted to be active in cortical actin cytoskeleton and plasma membrane. Is expressed in several structures, including cardiovascular system; endocrine gland; genitourinary system; gut; and nasal cavity epithelium. Orthologous to human LLGL2 (LLGL scribble cell polarity complex component 2).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 620-819 of mouse LLGL2 (NP_663413.2).
Sequence	RQVFVKCTLHPSDQLALEGPLSRVKSLKKSLRQSFRRMRRSRVSSHKRRPGGPTGEAQAQAVNIKAERTGLQNMELAPVQRKIEARSAEDSFTGFVRTLYFADTYLRDSSRHCPSLWAGTNGGTVYAFSLRVPPAERRTDEPVRAEQAKEIQLMHRAPVVGILVLDGHNVPLPEPLEVAHDLSKSPDMQGSHQLLVVSEE
Gene ID
Swiss Prot
Synonyms	Llglh2; 9130006H11Rik
Calculated MW	114kDa
Observed MW	113kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	MCF7, Mouse liver, Rat liver
Cellular location	Cytoplasm