제품 > 항체 > 다중클론항체(pAb)

LY6D Rabbit pAb (A17570)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using LY6D Rabbit pAb (A17570) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	LY6D Rabbit pAb
Catalog No.	A17570
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to be involved in lymphocyte differentiation. Predicted to act upstream of or within response to stilbenoid. Predicted to be located in extracellular region and plasma membrane. Predicted to be active in cell surface.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 25-95 of human LY6D (NP_003686.1).
Sequence	VCTSSSNCKHSVVCPASSRFCKTTNTVEPLRGNLVKKDCAESCTPSYTLQGQVSSGTSSTQCCQEDLCNEK
Gene ID
Swiss Prot
Synonyms	E48; Ly-6D; LY6D
Calculated MW	13kDa
Observed MW	16kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse spleen, Mouse thymus
Cellular location	cell surface, extracellular region, plasma membrane
Customer validation	WB(Mus musculus)