제품 > 항체 > 다중클론항체(pAb)

Lyve1 Rabbit pAb (A23673)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of various lysates, using Lyve1 Rabbit pAb (A23673) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Overview

Product name	Lyve1 Rabbit pAb
Catalog No.	A23673
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables hyaluronic acid binding activity and transmembrane signaling receptor activity. Acts upstream of or within glycosaminoglycan catabolic process. Located in plasma membrane. Is expressed in several structures, including cardiovascular system; gut; hemolymphoid system; meninges; and metanephros. Orthologous to human LYVE1 (lymphatic vessel endothelial hyaluronan receptor 1).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 30-228 of mouse Lyve1. (NP_444477.2).
Sequence	LSISTCRIMGVALVGRNKNPQMNFTEANEACKMLGLTLASRDQVESAQKSGFETCSYGWVGEQFSVIPRIFSNPRCGKNGKGVLIWNAPSSQKFKAYCHNSSDTWVNSCIPEIVTTFYPVLDTQTPATEFSVSSSAYLASSPDSTTPVSATTRAPPLTSMARKTKKICITEVYTEPITMATETEAFVASGAAFKNEAAG
Gene ID
Swiss Prot
Synonyms	Xlkd1; Lyve-1; Crsbp-1; 1200012G08Rik; Lyve1
Calculated MW	34kDa
Observed MW	50-70kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse lung, Rat lung
Cellular location