Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | MANEA Rabbit pAb |
---|---|
Catalog No. | A10756 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-100 of human MANEA (NP_078917.2). |
---|---|
Sequence | RPNTATFGAPFGLDLLPELHQRTIHLGKNFDFQKSDRINSETNTKNLKSVEITMKPSKASELNLDELPPLN |
Gene ID | |
Swiss Prot | |
Synonyms | ENDO; hEndo; MANEA |
Calculated MW | 54kDa |
Observed MW | 54kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | 293T, U-87MG |
Cellular location | Golgi apparatus membrane, Single-pass type II membrane protein |
* For research use only. Not for therapeutic or diagnostic purposes.