제품 > 항체 > 단일클론항체(mAb)

MGEA5/OGA Rabbit mAb (A24124)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from Mouse heart using MGEA5/OGA Rabbit mAb(A24124) at 1:3000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime:30s.

ABclonal:Immunohistochemistry - MGEA5/OGA Rabbit mAb (A24124)

Immunohistochemistry analysis of MGEA5/OGA in paraffin-embedded rat spleen tissue using MGEA5/OGA Rabbit mAb (A24124) at a dilution of 1:300 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of MGEA5/OGA in paraffin-embedded mouse colon tissue using MGEA5/OGA Rabbit mAb (A24124) at a dilution of 1:300 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Overview

Product name	MGEA5/OGA Rabbit mAb
Catalog No.	A24124
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC65434

Background

The dynamic modification of cytoplasmic and nuclear proteins by O-linked N-acetylglucosamine (O-GlcNAc) addition and removal on serine and threonine residues is catalyzed by OGT (MIM 300255), which adds O-GlcNAc, and MGEA5, a glycosidase that removes O-GlcNAc modifications (Gao et al., 2001 [PubMed 11148210]).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 433-633 of human MGEA5/OGA（NP_036347.1） .
Sequence	YQEPIMSQGAALSGEPTTLTKEEEKKQPDEEPMDMVVEKQEETDHKNDNQILSEIVEAKMAEELKPMDTDKESIAESKSPEMSMQEDCISDIAPMQTDEQTNKEQFVPGPNEKPLYTAEPVTLEDLQLLADLFYLPYEHGPKGAQMLREFQWLRANSSVVSVNCKGKDSEKIEEWRSRAAKFEEMCGLVMGMFTRLSNCAN
Gene ID
Swiss Prot
Synonyms	MEA5; MGEA5; NCOAT
Calculated MW	103kDa
Observed MW	130kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IHC-P 1:100 - 1:500
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Mouse heart
Cellular location	Cytoplasm, Nucleus