제품 > 항체 > 단일클론항체(mAb)

MIB1/DIP1 Rabbit mAb (A3371)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using MIB1/DIP1 Rabbit mAb (A3371) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

Overview

Product name	MIB1/DIP1 Rabbit mAb
Catalog No.	A3371
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1958

Background

This gene encodes a protein containing multiple ankyrin repeats and RING finger domains that functions as an E3 ubiquitin ligase. The encoded protein positively regulates Notch signaling by ubiquitinating the Notch receptors, thereby facilitating their endocytosis. This protein may also promote the ubiquitination and degradation of death-associated protein kinase 1 (DAPK1).

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MIB1/DIP1 (Q86YT6).
Sequence	MSNSRNNRVMVEGVGARVVRGPDWKWGKQDGGEGHVGTVRSFESPEEVVVVWDNGTAANYRCSGAYDLRILDSAPTGIKHDGTMCDTCRQQPIIGIRWKC
Gene ID
Swiss Prot
Synonyms	MIB; DIP1; ZZZ6; DIP-1; LVNC7; ZZANK2
Calculated MW	110kDa
Observed MW	110kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	293T, K-562, U-87MG, Mouse lung, Mouse testis, Mouse brain, Rat brain
Cellular location	Cell membrane, Cytoplasm, centriolar satellite, centrosome, cytoskeleton, microtubule organizing center