Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | MIB1/DIP1 Rabbit mAb |
---|---|
Catalog No. | A3371 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC1958 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MIB1/DIP1 (Q86YT6). |
---|---|
Sequence | MSNSRNNRVMVEGVGARVVRGPDWKWGKQDGGEGHVGTVRSFESPEEVVVVWDNGTAANYRCSGAYDLRILDSAPTGIKHDGTMCDTCRQQPIIGIRWKC |
Gene ID | |
Swiss Prot | |
Synonyms | MIB; DIP1; ZZZ6; DIP-1; LVNC7; ZZANK2 |
Calculated MW | 110kDa |
Observed MW | 110kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | 293T, K-562, U-87MG, Mouse lung, Mouse testis, Mouse brain, Rat brain |
Cellular location | Cell membrane, Cytoplasm, centriolar satellite, centrosome, cytoskeleton, microtubule organizing center |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.