제품 > 항체 > 단일클론항체(mAb)

MSRB3 Rabbit mAb (A20980)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using MSRB3 antibody (A20980) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	MSRB3 Rabbit mAb
Catalog No.	A20980
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2972

Background

The protein encoded by this gene catalyzes the reduction of methionine sulfoxide to methionine. This enzyme acts as a monomer and requires zinc as a cofactor. Several transcript variants encoding two different isoforms have been found for this gene. One of the isoforms localizes to mitochondria while the other localizes to endoplasmic reticula.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 50-192 of human MSRB3 (Q8IXL7).
Sequence	LRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAEL
Gene ID
Swiss Prot
Synonyms	DFNB74
Calculated MW	21kDa
Observed MW	21kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	A-549, U2OS, HeLa, Jurkat, Mouse testis, Rat heart, Rat lung
Cellular location	Endoplasmic reticulum, Mitochondrion