제품 > 항체 > 다중클론항체(pAb)

Monoamine Oxidase A (MAOA) Rabbit pAb (A1354)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Monoamine Oxidase A (MAOA) Rabbit pAb (A1354) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

ABclonal:Immunohistochemistry - Monoamine Oxidase A (MAOA) Rabbit pAb (A1354)

Immunohistochemistry analysis of paraffin-embedded rat brain using Monoamine Oxidase A (MAOA) Rabbit pAb (A1354) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human thyroid cancer using Monoamine Oxidase A (MAOA) Rabbit pAb (A1354) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse brain using Monoamine Oxidase A (MAOA) Rabbit pAb (A1354) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Monoamine Oxidase A (MAOA) Rabbit pAb (A1354)

Immunofluorescence analysis of C6 cells using Monoamine Oxidase A (MAOA) Rabbit pAb (A1354) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH/3T3 cells using Monoamine Oxidase A (MAOA) Rabbit pAb (A1354) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	Monoamine Oxidase A (MAOA) Rabbit pAb
Catalog No.	A1354
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene is one of two neighboring gene family members that encode mitochondrial enzymes which catalyze the oxidative deamination of amines, such as dopamine, norepinephrine, and serotonin. Mutation of this gene results in Brunner syndrome. This gene has also been associated with a variety of other psychiatric disorders, including antisocial behavior. Alternatively spliced transcript variants encoding multiple isoforms have been observed.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human Monoamine Oxidase A (Monoamine Oxidase A (MAOA)) (NP_000231.1).
Sequence	MENQEKASIAGHMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHVDYVDVGGAYVGPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIAYLDYNNLWRTIDNMGKEIPTDAPWEAQHADKWDKMTMKELIDKICWTKTARRFAYLFVNINVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSERIMDLLGDQVKLNHPVTHVDQSSDNIIIETLN
Gene ID
Swiss Prot
Synonyms	BRNRS; MAO-A; Monoamine Oxidase A (MAOA)
Calculated MW	61kDa
Observed MW	65kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	A-549, PC-3, HeLa, HT-29, Mouse lung, Mouse intestine, Mouse kidney, Mouse liver, NCI-H460
Cellular location	Cytoplasmic side, Mitochondrion outer membrane, Single-pass type IV membrane protein
Customer validation	WB(Mus musculus, Gallus gallus, Felis catus)