Monoamine Oxidase A (MAOA) Rabbit pAb (A14024)

Datasheet

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

ABclonal:Immunofluorescence - Monoamine Oxidase A (MAOA) Rabbit pAb (A14024)

Immunofluorescence analysis of HeLa cells using Monoamine Oxidase A (Monoamine Oxidase A (MAOA)) antibody (A14024). Blue: DAPI for nuclear staining.

Overview

Product name	Monoamine Oxidase A (MAOA) Rabbit pAb
Catalog No.	A14024
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

This gene is one of two neighboring gene family members that encode mitochondrial enzymes which catalyze the oxidative deamination of amines, such as dopamine, norepinephrine, and serotonin. Mutation of this gene results in Brunner syndrome. This gene has also been associated with a variety of other psychiatric disorders, including antisocial behavior. Alternatively spliced transcript variants encoding multiple isoforms have been observed.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human Monoamine Oxidase A (Monoamine Oxidase A (MAOA)) (NP_000231.1).
Sequence	MENQEKASIAGHMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHVDYVDVGGAYVGPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIAYLDYNNLWRTIDNMGKEIPTDAPWEAQHADKWDKMTMKELIDKICWTKTARRFAYLFVNINVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSERIMDLLGDQVKLNHPVTHVDQSSDNIIIETLN
Gene ID
Swiss Prot
Synonyms	BRNRS; MAO-A
Calculated MW	61kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Immunofluorescence
Positive samples
Cellular location	Cytoplasmic side, Mitochondrion outer membrane, Single-pass type IV membrane protein