제품 > 항체 > 단일클론항체(mAb)

Mouse G-CSF Rabbit mAb (A24423)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Western blot analysis of lysates from Mouse G-CSF, using Mouse G-CSF Rabbit mAb (A24423) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	Mouse G-CSF Rabbit mAb
Catalog No.	A24423
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC63775

Background

Enables granulocyte colony-stimulating factor receptor binding activity. Acts upstream of or within positive regulation of myeloid cell differentiation. Predicted to be located in endocytic vesicle lumen and extracellular region. Predicted to be active in extracellular space. Is expressed in several structures, including brain; dorsal aorta; liver; reproductive system; and yolk sac. Human ortholog(s) of this gene implicated in several diseases, including allergic cutaneous vasculitis; artery disease (multiple); ischemia (multiple); leukemia (multiple); and lung disease (multiple). Orthologous to human CSF3 (colony stimulating factor 3).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 31-208 of mouse G-CSF(NP_034101.1).
Sequence	VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA
Gene ID
Swiss Prot
Synonyms	Csfg; G-CSF; MGI-IG; Mouse G-CSF
Calculated MW	22kDa
Observed MW	50-60kDa

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Recombinant protein of mouse G-CSF
Cellular location	Secreted.