제품 > 항체 > 다중클론항체(pAb)

NAA20 Rabbit pAb (A7105)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using NAA20 Rabbit pAb (A7105) at 1:1000 dilution._Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25μg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 90s.

ABclonal:Immunohistochemistry - NAA20 Rabbit pAb (A7105)

Immunohistochemistry analysis of paraffin-embedded Rat kidney using NAA20 Rabbit pAb (A7105) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human oophoroma using NAA20 Rabbit pAb (A7105) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

ABclonal:Immunoprecipitation - NAA20 Rabbit pAb (A7105)

Immunoprecipitation analysis of 200 μg extracts of MCF7 cells using 1 μg NAA20 antibody (A7105). Western blot was performed from the immunoprecipitate using NAA20 antibody (A7105) at a dilution of 1:1000.

Overview

Product name	NAA20 Rabbit pAb
Catalog No.	A7105
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

NAT5 is a component of N-acetyltransferase complex B (NatB). Human NatB performs cotranslational N(alpha)-terminal acetylation of methionine residues when they are followed by asparagine (Starheim et al., 2008 [PubMed 18570629]).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 49-178 of human NAA20 (NP_057184.1).
Sequence	PGGELMGYIMGKAEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSIIPLPHPVRPEDIE
Gene ID
Swiss Prot
Synonyms	NAT3; NAT5; MRT73; NAT3P; NAT5P; dJ1002M8.1; NAA20
Calculated MW	20kDa
Observed MW	20kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	HeLa, Mouse brain, Mouse kidney, Rat brain
Cellular location	Cytoplasm, Nucleus.
Customer validation	WB(Homo sapiens)