Reviews (4)Publication (1) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | NCAM1 / CD56 Rabbit pAb |
---|---|
Catalog No. | A0393 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 759-858 of human NCAM1 / CD56 (NP_851996.2). |
---|---|
Sequence | LCGKAGPGAKGKDMEEGKAAFSKDESKEPIVEVRTEEERTPNHDGGKHTEPNETTPLTEPEKGPVEAKPECQETETKPAPAEVKTVPNDATQTKENESKA |
Gene ID | |
Swiss Prot | |
Synonyms | CD56; NCAM; MSK39; NCAM1 / CD56 |
Calculated MW | 95kDa |
Observed MW | 120kDa/140kDa/180kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | Mouse brain tissue |
Cellular location | Cell membrane, GPI-anchor, Lipid-anchor, Secreted, Single-pass type I membrane protein |
Customer validation | (Mouse lung tumor, Mouse normal liver,Mouse lung tumor, Mouse C3 primary cells) WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A0393? Please let us know so that we can cite the reference in this datasheet.