Reviews (2)Publications (10) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using NCAM1 / CD56 Rabbit pAb (A7913) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Western blot analysis of lysates from SH-SY5Y cells using NCAM1 / CD56 Rabbit pAb (A7913) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using NCAM1 / CD56 Rabbit pAb (A7913) at a dilution of 1:100 (40x lens). Microwave antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using NCAM1 / CD56 Rabbit pAb (A7913) at a dilution of 1:100 (40x lens). Microwave antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
Immunofluorescence analysis of rat brain cells using NCAM1 / CD56 Rabbit pAb (A7913) at dilution of 1:20 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of SH-SY5Y cells using NCAM1 / CD56 Rabbit pAb (A7913) at dilution of 1:20 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Product name | NCAM1 / CD56 Rabbit pAb |
|---|---|
| Catalog No. | A7913 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 759-858 of human NCAM1 / CD56 (NP_851996.2). |
|---|---|
| Sequence | LCGKAGPGAKGKDMEEGKAAFSKDESKEPIVEVRTEEERTPNHDGGKHTEPNETTPLTEPEKGPVEAKPECQETETKPAPAEVKTVPNDATQTKENESKA |
| Gene ID | |
| Swiss Prot | |
| Synonyms | CD56; NCAM; MSK39; NCAM1 / CD56 |
| Calculated MW | 95kDa |
| Observed MW | 120-220kDa/ |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | SH-SY5Y, Mouse brain, Rat brain, Mouse brain, Rat brain, SH-SY5Y |
| Cellular location | Cell membrane, GPI-anchor, Lipid-anchor, Secreted, Single-pass type I membrane protein. |
| Customer validation | (mouse brain, Rat hippocampus) WB(Homo sapiens, Chlorocebus aethiops) IHC(Mus musculus) IF(Homo sapiens) Co-IP(Homo sapiens,Mus musculus) IF(Homo sapiens,Mus musculus) IHC(Homo sapiens,Mus musculus) IP(Homo sapiens,Mus musculus) WB(Homo sapiens,Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A7913? Please let us know so that we can cite the reference in this datasheet.
