Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | NDC1 Rabbit pAb |
---|---|
Catalog No. | A17727 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 340-530 of human NDC1 (NP_060557.3). |
---|---|
Sequence | QYSPSRRQEVFSLSQPGGHPHNWTAISRECLNLLNGMTQKLILYQEAAATNGRVSSSYPVEPKKLNSPEETAFQTPKSSQMPRPSVPPLVKTSLFSSKLSTPDVVSPFGTPFGSSVMNRMAGIFDVNTCYGSPQSPQLIRRGPRLWTSASDQQMTEFSNPSPSTSISAEGKTMRQPSVIYSWIQNKREQIK |
Gene ID | |
Swiss Prot | |
Synonyms | NET3; TMEM48; NDC1 |
Calculated MW | 76kDa |
Observed MW | 76kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | MCF7, Jurkat, HeLa, Mouse heart, Mouse brain |
Cellular location | actin cytoskeleton, cytoplasm, nuclear envelope, nuclear membrane, nuclear pore, nuclear pore transmembrane ring, plasma membrane. |
Customer validation | WB(Mus musculus, Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A17727? Please let us know so that we can cite the reference in this datasheet.