제품 > 항체 > 다중클론항체(pAb)

NDUFS3 Rabbit pAb (A8013)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using NDUFS3 Rabbit pAb (A8013) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime: 90s.

ABclonal:Immunoprecipitation - NDUFS3 Rabbit pAb (A8013)

Immunoprecipitation analysis of 600 μg extracts of Mouse kidney using 3 μg NDUFS3 antibody (A8013). Western blot was performed from the immunoprecipitate using NDUFS3 antibody (A8013) at a dilution of 1:1000.

Overview

Product name	NDUFS3 Rabbit pAb
Catalog No.	A8013
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes one of the iron-sulfur protein (IP) components of mitochondrial NADH:ubiquinone oxidoreductase (complex I). Mutations in this gene are associated with Leigh syndrome resulting from mitochondrial complex I deficiency.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 37-264 of human NDUFS3 (NP_004542.1).
Sequence	ESAGADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK
Gene ID
Swiss Prot
Synonyms	CI-30; MC1DN8; NDUFS3
Calculated MW	30kDa
Observed MW	26kDa/30kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IP 0.5μg-4μg antibody for 400μg-600μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	HepG2, Mouse kidney, Mouse heart, Mouse skeletal muscle, Rat kidney, Rat heart, Rat skeletal muscle, MCF7, Rat heart
Cellular location	Mitochondrion inner membrane
Customer validation	WB(Mus musculus, Eriocheir sinensis H.Milne-Edwards)