제품 > 항체 > 다중클론항체(pAb)

NGB Rabbit pAb (A6477)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Western blot analysis of lysates from Mouse brain, using NGB Rabbit pAb (A6477) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

Review

Overview

Product name	NGB Rabbit pAb
Catalog No.	A6477
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes an oxygen-binding protein that is distantly related to members of the globin gene family. It is highly conserved among other vertebrates. It is expressed in the central and peripheral nervous system where it may be involved in increasing oxygen availability and providing protection under hypoxic/ischemic conditions.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-151 of human NGB (NP_067080.1).
Sequence	MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGE
Gene ID
Swiss Prot
Synonyms	NGB
Calculated MW	17kDa
Observed MW	17kDa

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse brain
Cellular location	Cytoplasm, Mitochondrion, Perikaryon.
Customer validation	(293T, Cortical neurons)