제품 > 항체 > 단일클론항체(mAb)

NHLH1 Rabbit mAb (A24160)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from wild type (WT) and 293T cells transfected with NHLH1 using NHLH1 Rabbit mAb (A24160) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.

ABclonal:Immunoprecipitation - NHLH1 Rabbit mAb (A24160)

Immunoprecipitation of NHLH1 in 300 µg extracts from 293F cells transfected with NHLH1, using 3 µg NHLH1 Rabbit mAb (A24160). Western blot was performed from the Immunoprecipitate using NHLH1 Rabbit mAb (A24828) at 1:1000 dilution.

ABclonal:Chromatin Immunoprecipitation - NHLH1 Rabbit mAb (A24160)

Chromatin immunoprecipitation was performed with cross-linked chromatin from 293T cells transfected with NHLH1 , using NHLH1 Rabbit mAb (A24160) and rabbit IgG (AC042). The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram compares the ratio of the immunoprecipitated DNA versus the input.

Overview

Product name	NHLH1 Rabbit mAb
Catalog No.	A24160
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC63732

Background

The helix-loop-helix (HLH) proteins are a family of putative transcription factors, some of which have been shown to play an important role in growth and development of a wide variety of tissues and species. Four members of this family have been clearly implicated in tumorigenesis via their involvement in chromosomal translocations in lymphoid tumors: MYC (MIM 190080), LYL1 (MIM 151440), E2A (MIM 147141), and SCL (MIM 187040).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human NHLH1 (NP_005589.1).
Sequence	MMLNSDTMELDLPPTHSETESGFSDCGGGAGPDGAGPGGPGGGQARGPEPGEPGRKDLQH
Gene ID
Swiss Prot
Synonyms	HEN1; NSCL; NSCL1; bHLHa35; NHLH1
Calculated MW	15kDa
Observed MW	22kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:3000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements. ChIP 5μg antibody for 10μg-15μg of Chromatin
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	293T transfected with NHLH1 (Human)
Cellular location	Nucleus.