제품 > 항체 > 단일클론항체(mAb)

NHLH1 Rabbit mAb (A24828)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from wild type (WT) and 293T cells transfected with NHLH1, using NHLH1 Rabbit mAb (A24828) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.

ABclonal:Immunofluorescence - NHLH1 Rabbit mAb (A24828)

Confocal imaging of 293F cells transfected with NHLH1 using NHLH1 Rabbit mAb (A24828, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (blue). Objective: 100x.

ABclonal:Immunoprecipitation - NHLH1 Rabbit mAb (A24828)

Immunoprecipitation of NHLH1 in 300 µg extracts from 293F cells transfected with NHLH1 using 2 µg NHLH1 Rabbit mAb (A24828). Western blot analysis was performed using NHLH1 Rabbit mAb (A24828) at 1:1000 dilution.

Overview

Product name	NHLH1 Rabbit mAb
Catalog No.	A24828
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC64632

Background

The helix-loop-helix (HLH) proteins are a family of putative transcription factors, some of which have been shown to play an important role in growth and development of a wide variety of tissues and species. Four members of this family have been clearly implicated in tumorigenesis via their involvement in chromosomal translocations in lymphoid tumors: MYC (MIM 190080), LYL1 (MIM 151440), E2A (MIM 147141), and SCL (MIM 187040).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human NHLH1 (NP_005589.1).
Sequence	MMLNSDTMELDLPPTHSETESGFSDCGGGAGPDGAGPGGPGGGQARGPEPGEPGRKDLQH
Gene ID
Swiss Prot
Synonyms	HEN1; NSCL; NSCL1; bHLHa35; NHLH1
Calculated MW	15kDa
Observed MW	22kDa/

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:4000 IF/ICC 1:200 - 1:400 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	293T transfected with NHLH1 (Human)
Cellular location	Nucleus.