제품 > 항체 > 단일클론항체(mAb)

NNMT Rabbit PolymAb® (A25906PM)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using NNMT Rabbit PolymAb® (A25906PM) at 1:1900 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): HAP1
Exposure time: 1s.

ABclonal:Immunofluorescence - NNMT Rabbit PolymAb® (A25906PM)

Confocal imaging of HeLa cells using NNMT Rabbit PolymAb® (A25906PM, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.

ABclonal:Immunoprecipitation - NNMT Rabbit PolymAb® (A25906PM)

Immunoprecipitation of NNMT from 300 µg extracts of HeLa cells was performed using 0.5 µg of NNMT Rabbit PolymAb® (A25906PM). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using NNMT Rabbit PolymAb® (A25906PM) at a dilution of 1:2000.

Overview

Product name	NNMT Rabbit PolymAb®
Catalog No.	A25906PM
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver. This gene encodes the protein responsible for this enzymatic activity which uses S-adenosyl methionine as the methyl donor.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-264 of human NNMT (NP_006160.1).
Sequence	MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL
Gene ID
Swiss Prot
Synonyms	Nicotinamide N-methyltransferase
Calculated MW	30kDa
Observed MW	28kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	HeLa,
Cellular location	Cytoplasm.