제품 > 항체 > 다중클론항체(pAb)

NPFFR2 Rabbit pAb (A10664)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of various lysates using NPFFR2 Rabbit pAb (A10664) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	NPFFR2 Rabbit pAb
Catalog No.	A10664
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a member of a subfamily of G-protein-coupled neuropeptide receptors. This protein is activated by the neuropeptides A-18-amide (NPAF) and F-8-amide (NPFF) and may function in pain modulation and regulation of the opioid system. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human NPFFR2 (NP_004876.2).
Sequence	MNSFFGTPAASWCLLESDVSSAPDKEAGRERRALSVQQRGGPAWSGSLEWSRQSAGDRRRLGLSRQTAKSSWSRSRDRTCCCRRAWWILVPAADRARRERFIMNEKWDTNSSENWHPIWNVNDTKHHLYSDINITYVNYY
Gene ID
Swiss Prot
Synonyms	GPR74; NPFF2; NPGPR; HLWAR77; NPFFR2
Calculated MW	60kDa
Observed MW	48kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse brain, Rat brain
Cellular location	Cell membrane, Multi-pass membrane protein
Customer validation	IF(Mus musculus) WB(Mus musculus)