Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | NUR77 Rabbit pAb |
---|---|
Catalog No. | A6676 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human NUR77 (NP_002126.2). |
---|---|
Sequence | KYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDA |
Gene ID | |
Swiss Prot | |
Synonyms | HMR; N10; TR3; NP10; GFRP1; NAK-1; NGFIB; NUR77 |
Calculated MW | 64kDa |
Observed MW | 64kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | Mouse testis |
Cellular location | Cytoplasm, Nucleus |
Customer validation | IHC(Homo sapiens) WB(Sus domesticus, Homo sapiens, Rattus norvegicus, Capra hircus, Rattus norvegicus) IHC(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A6676? Please let us know so that we can cite the reference in this datasheet.