제품 > 항체 > 다중클론항체(pAb)

NUR77 Rabbit pAb (A6676)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of lysates from Mouse testis, using NUR77 Rabbit pAb (A6676) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

ABclonal:Immunohistochemistry - NUR77 Rabbit pAb (A6676)

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using NUR77 Rabbit pAb (A6676) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human tonsil using NUR77 Rabbit pAb (A6676) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Overview

Product name	NUR77 Rabbit pAb
Catalog No.	A6676
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. Expression is induced by phytohemagglutinin in human lymphocytes and by serum stimulation of arrested fibroblasts. The encoded protein acts as a nuclear transcription factor. Translocation of the protein from the nucleus to mitochondria induces apoptosis. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 300-400 of human NUR77 (NP_002126.2).
Sequence	KYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDA
Gene ID
Swiss Prot
Synonyms	HMR; N10; TR3; NP10; GFRP1; NAK-1; NGFIB; NUR77
Calculated MW	64kDa
Observed MW	64kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Mouse testis
Cellular location	Cytoplasm, Nucleus
Customer validation	IHC(Homo sapiens) WB(Sus domesticus, Homo sapiens, Rattus norvegicus, Capra hircus) IHC(Rattus norvegicus)